PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00021.296
Common NameAMTR_s00021p00254030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 26936.8 Da    PI: 9.2423
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00021.296genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.41.4e-31958150
                                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                              krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  evm_27.model.AmTr_v1.0_scaffold00021.296  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 58
                                              79***********************************************8 PP

2K-box105.56.3e-35781735100
                                     K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73 
                                               ++  ++ea+++++qqe+akL+++i+ L +++R+l+G++++s+++keL+ Le++Lek+++kiRskKnell
  evm_27.model.AmTr_v1.0_scaffold00021.296  78 HSGTVSEANSQYYQQEAAKLRNQIQVLTNTNRQLMGDSVGSMTVKELRTLENKLEKGISKIRSKKNELL 146
                                               333499*************************************************************** PP

                                     K-box  74 leqieelqkkekelqeenkaLrkklee 100
                                               +++i+++q++e elq++n+ Lr+k++e
  evm_27.model.AmTr_v1.0_scaffold00021.296 147 FAEIDYMQNRELELQKDNMLLRAKIAE 173
                                               ************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006634.132161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-42160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-33274IPR002100Transcription factor, MADS-box
CDDcd002652.67E-46276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-33323IPR002100Transcription factor, MADS-box
PfamPF003198.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-333859IPR002100Transcription factor, MADS-box
PfamPF014869.7E-2884171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.63587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYANN  60
SVKTTIDRYK KACADSSHSG TVSEANSQYY QQEAAKLRNQ IQVLTNTNRQ LMGDSVGSMT  120
VKELRTLENK LEKGISKIRS KKNELLFAEI DYMQNRELEL QKDNMLLRAK IAENERAQHM  180
NMLPGPEYDV LPPFDSRNYL QVNLLEPNHH NYSHQEQTAL QLGSFIILLL ACIY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-21169169Myocyte-specific enhancer factor 2B
1tqe_R4e-21169169Myocyte-specific enhancer factor 2B
1tqe_Q4e-21169169Myocyte-specific enhancer factor 2B
1tqe_P4e-21169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9362310.0AY936231.1 Amborella trichopoda AG (AG) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011626333.11e-166PREDICTED: floral homeotic protein AGAMOUS isoform X1
SwissprotQ408721e-118AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLW1PVX31e-175W1PVX3_AMBTC; Uncharacterized protein
STRINGVIT_12s0142g00360.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-113MIKC_MADS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]